Yahoo Web Search

Search results

1. Dictionary

   wave

   /weɪv/

   verb

   • 1. move one's hand to and fro in greeting or as a signal: "he waved to me from the train" Similar gesturegesticulatesignalsignbeckonindicatemotionnodbid
   • ▪ move (one's hand or arm, or something held in one's hand) to and fro: "he waved a sheaf of papers in the air" Similar move to and fromove up and downwagwaggleswingshakeswishsweepswipebrandishflourishflauntwieldflickflutter
   • ▪ convey (a greeting or other message) by waving one's hand or something held in it: "we waved our farewells"
   • ▪ instruct (someone) to move in a particular direction by moving one's hand: "he waved her back"
   • 2. move to and fro with a swaying motion while remaining fixed to one point: "the flag waved in the wind" Similar rippleflutterundulatestirflapswayswingwaftshakequiveroscillatemoveblow
   • 3. style (hair) so that it curls slightly: "her hair had been carefully waved for the evening"
   • ▪ (of hair) grow with a slight curl: "she marvelled at the blueness of his eyes, how straight his nose was, the way his hair waved" Similar curlkinkcoilundulatecrimpfrizzfrizzle

   noun

   • 1. a long body of water curling into an arched form and breaking on the shore: "he was swept out to sea by a freak wave" Similar breakerbillowrollercomberripplewhite horsewhite capswellsurffrothbomborainformal:boomerkahuna
   • ▪ a ridge of water between two depressions in open water: "gulls and cormorants bobbed on the waves"
   • ▪ a shape regarded as resembling a breaking wave: "a wave of treetops stretched to the horizon"
   • ▪ the sea. literary
   • 2. a sudden occurrence of or increase in a phenomenon, feeling, or emotion: "its remarkable how one small gesture can create a wave of kindness" Similar flowrushsurgefloodstreamswelltidedelugetorrentspatebillowsurgerushripplespasmthrillfrissonshivertinglestabdartupsurgewelling upoutbreakrashfeeling
   • 3. a gesture or signal made by moving one's hand to and fro: "he gave a little wave and walked off" Similar gesturegesticulationhand movementsignalsignmotionindication
   • 4. a slightly curling lock of hair: "his hair was drying in unruly waves" Similar curlkinkcorkscrewcrimptwisttwirlringletfrizzcoilloopundulation
   • ▪ a tendency to curl in a person's hair: "her hair has a slight natural wave" Similar curlkinkcorkscrewcrimptwisttwirlringletfrizzcoilloopundulation
   • 5. a periodic disturbance of the particles of a substance which may be propagated without net movement of the particles, such as in the passage of undulating motion, heat, or sound. Similar ripplevibrationoscillationundulation
   • ▪ a single curve in the course of a periodic disturbance of the particles of a substance.
   • ▪ a periodic variation of an electromagnetic field in the propagation of light or other radiation through a medium or vacuum.

   Word Origin Old Englishwafian (verb), from the Germanic base of waver; the noun by alteration (influenced by the verb) of Middle English wawe ‘(sea) wave’.

   Derivatives

   • 1. waveless adjective
   • 2. wave-like adjective

   Scrabble Points: 10

   • W

     4

   • A

     1

   • V

     4

   • E

     1

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. www.merriam-webster.com › dictionary › waveWave Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › wave

   • Cached

   The meaning of WAVE is to motion with the hands or with something held in them in signal or salute. How to use wave in a sentence. Synonym Discussion of Wave.

3. dictionary.cambridge.org › dictionary › englishWAVE | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   WAVE definition: 1. to raise your hand and move it from side to side as a way of greeting someone, telling someone…. Learn more.

4. www.dictionary.com › browse › waveWAVE Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › wave

   • Cached

   noun. one of a sequence of ridges or undulations that moves across the surface of a body of a liquid, esp the sea: created by the wind or a moving object and gravity. any undulation on or at the edge of a surface reminiscent of such a wave. a wave across the field of corn. the waves.

5. www.britannica.com › science › wave-physicsWave | Behavior, Definition, & Types | Britannica

   www.britannica.com › science › wave-physics

   • Cached

   May 14, 2024 · wave, propagation of disturbances from place to place in a regular and organized way. Most familiar are surface waves that travel on water, but sound, light, and the motion of subatomic particles all exhibit wavelike properties.

6. www.oxfordlearnersdictionaries.com › definition › englishwave noun - Definition, pictures, pronunciation and usage notes...

   www.oxfordlearnersdictionaries.com › definition › english

   • Cached

   Definition of wave noun from the Oxford Advanced Learner's Dictionary. wave. noun. /weɪv/ Idioms. of water. [countable] a raised line of water that moves across the surface of the sea, ocean, etc. Huge waves were breaking on the shore. Surfers flocked to the beach to ride the waves. the gentle sound of waves lapping.

7. www.thefreedictionary.com › waveWave - definition of wave by The Free Dictionary

   www.thefreedictionary.com › wave

   • Cached

   1. To cause to move back and forth or up and down, either once or repeatedly: She waved a fan before her face. 2. a. To move or swing as in giving a signal: He waved his hand. See Synonyms at flourish. b. To signal or express by waving the hand or an object held in the hand: We waved goodbye. c.

8. www.vocabulary.com › dictionary › waveWave - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › wave

   Use the verb wave to describe a greeting that includes a hand motion, from the enthusiastic flapping wave of a little kid meeting his dad at the airport to the prim wave of a Queen acknowledging her subjects.