Yahoo Web Search

Search results

1. Dictionary

   want

   /wɒnt/

   verb

   • 1. have a desire to possess or do (something); wish for: "I want an apple" Similar desirewish forhope forfancyhave a fancy fortake a fancy tohave an inclination forcare forlikeset one's heart onlong foryearn forpine forsigh forcravehanker afterhunger forthirst forlust aftercry out forbe desperate foritch forcovetneedbe bent oninformal:have a yen forbe dying for
   • ▪ wish to speak to (someone): "Tony wants me in the studio"
   • ▪ (of a suspected criminal) be sought by the police for questioning: "he is wanted by the police in connection with an arms theft"
   • ▪ desire (someone) sexually: "I've wanted you since the first moment I saw you"
   • ▪ desire to be in or out of a particular place or situation: informal North American "if anyone wants out, there's the door"
   • 2. should or need to do something: informal "you don't want to believe everything you hear" Similar shouldoughtneedmust
   • ▪ (of a thing) require to be attended to in a specified way: British "the wheel wants greasing" Similar needbe/stand in need ofrequiredemandcry out for
   • 3. lack something desirable or essential: literary "you shall want for nothing while you are with me"
   • ▪ (chiefly used in expressions of time) lack or be short of (a specified amount or thing): archaic "it wanted twenty minutes to midnight"

   noun

   • 1. a lack or deficiency of something: "Victorian houses which are in want of repair" Similar lackabsencenon-existenceunavailabilitydearthdeficiencyinadequacyinsufficiencypaucityshortageshortfallshortnessscarcityscarcenessscantinessundersupplydeficitrare:exiguityOpposite abundancepresence
   • ▪ the state of being poor and in need of essentials; poverty: "freedom from want" Similar needneedinessausterityprivationdeprivationpovertyimpoverishmentimpecuniousnessimpecuniositypennilessnesspauperismpenurydestitutionfaminedroughtindigenceOpposite wealthplenty
   • 2. a desire for something: "the expression of our wants and desires" Similar wishdesiredemandlongingyearningfancycravinghankeringneedrequirementnecessityessentialrequisiteinformal:yen

   Word Origin Middle English: the noun from Old Norse vant, neuter of vanr ‘lacking’; the verb from Old Norse vanta‘be lacking’. The original notion of ‘lack’ was early extended to ‘need’ and from this developed the sense ‘desire’.

   Derivatives

   • 1. wanter noun

   Scrabble Points: 7

   • W

     4

   • A

     1

   • N

     1

   • T

     1

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. www.thebalancemoney.com › how-to-separate-wants-and-needs-453592Needs vs. Wants: Understanding the Difference - The Balance

   www.thebalancemoney.com › how-to-separate-wants-and-needs-453592

   • Cached

   Jun 18, 2024 · Parts of an expense may be categorized as a need while others are a want. A grocery bill is a need because you need to eat. But if, along with your produce, protein, and whole grains, you also buy chips and soda, then some of those things are wants rather than needs.

3. www.investopedia.com › difference-between-needs-and-wants-8612333What Is the Difference Between Needs and Wants? - Investopedia

   www.investopedia.com › difference-between-needs-and-wants-8612333

   • Cached

   May 1, 2024 · A need is anything that you require to maintain your physical, emotional, and financial health, while a want is anything extra. To a certain extent, needs and wants are subjective.

4. www.wikihow.com › Get-What-You-Want11 Ways to Get What You Want - wikiHow

   www.wikihow.com › Get-What-You-Want

   • Cached

   Mar 1, 2024 · Think about your life, career, relationships, and more. What do you want from them? What do you want in 5 years or 10? What smaller goals do you have to meet to get what you want? You'll only be able to create a solid plan for getting what you want once you have clear and detailed ideas.

   • Views: 85.5K

5. englishintelligent.com › want-or-wantsWant or Wants? What’s the Difference? - English Intelligent

   englishintelligent.com › want-or-wants

   • Cached

   Apr 6, 2024 · Want as a noun. Yes, “want” can be used as a noun. In this context, it means a lack or a need for something. For example, you could say “There is a want for more affordable housing in this city,” or “His want for attention was evident in the way he constantly sought validation from others.”

6. dictionaryblog.cambridge.org › 2023/09/06 › ways-of-saying-wantWays of saying 'want' - About Words - Cambridge Dictionary blog

   dictionaryblog.cambridge.org › 2023/09/06 › ways-of-saying-want

   Sep 6, 2023 · There are several nice, emphatic phrases for wanting something very much. For instance, if you set your heart on something or have your heart set on something, you really want it and would be very disappointed if you didn’t get it.

7. 7esl.com › want105+ Synonyms for “Want” with Examples - 7ESL

   7esl.com › want

   • Cached

   Jun 4, 2024 · What Is “Want”? “Want” is a versatile verb that we use to express a desire or need for something. It’s a common word that surfaces in our everyday language to communicate yearning or lacking. List of Synonyms for Want. Desire; Crave; Long for; Yearn for; Covet; Wish for; Hanker for; Aspire to; Pine for; Hunger for; Thirst for; Itch ...

8. study.com › academy › lessonNeeds vs. Wants in Psychology | Definition & Examples

   study.com › academy › lesson

   • Cached

   Nov 21, 2023 · Wants are desires that can improve the relationship, like respect, compassion, and empathy. What are some examples of needs and wants? Needs include basic food to provide...

9. economictopics.com › needs-and-wants-meaning-examples-and-differencesNeeds and wants: Meaning, examples and differences - Economic...

   economictopics.com › needs-and-wants-meaning-examples-and-differences

   • Cached

   Jun 27, 2023 · Difference between needs and wants. The main difference between needs vs wants is that, Needs means the basic requirements of a person. Wants means how people fulfill their needs. The following table explains the difference between a want and a need.

10. quickonomics.com › terms › wantWant Definition & Examples - Quickonomics

    quickonomics.com › terms › want

    • Cached

    Mar 22, 2024 · Definition of Want. A want refers to a desire or wish for something. In the context of economics, it is distinguished from a need as it is not essential for basic survival, but rather something that people aspire to have for reasons of pleasure, convenience, or status.

11. preply.com › en › blogDifferent ways to say “I want” in English - Preply

    preply.com › en › blog

    • Cached

    Jul 3, 2023 · To express a desire for something, “I want” is probably the first phrase that you think of. However, it is not the only way to express a wish in English. Yes, it is the most straightforward way, but we want to speak more than simple English, right?