Yahoo Web Search

Search results

1. www.forwardsingapore.gov.sgForward SG

   www.forwardsingapore.gov.sg

   • Cached

   We launched the Forward Singapore (Forward SG) exercise in June 2022, engaging Singaporeans from all walks of life on how we should refresh our social compact for the road ahead. What is a social compact?

   • 
   • 
   • 
   • 

2. dictionary.cambridge.org › dictionary › englishMeaning of forward in English - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   verb [ T ] uk / ˈfɔː.wəd / us / ˈfɔːr.wɚd /. to send a letter, etc., especially from someone's old address to their new address, or to send a letter, email, etc. that you have received to someone else: forward something to someone/something I'll forward any mail to your new address.

3. www.forwardsingapore.gov.sg › news › press-release-launch-ofForward SG

   www.forwardsingapore.gov.sg › news › press-release-launch-of

   • Cached

   Jun 28, 2022 · Forward Singapore is a collective effort led by DPM Wong and his 4G leadership team, working in partnership with Singaporeans, to review and refresh Singapore’s social compact and set out a roadmap for the next decade and beyond.

4. Dictionary

   forward

   /ˈfɔːwəd/

   adverb

   • 1. in the direction that one is facing or travelling; towards the front: "he started up the engine and the car moved forward" Similar aheadforwardsonwardsonwardonfurther
   • ▪ in or towards the bow or nose of a ship or aircraft.
   • ▪ in the normal order or sequence: "the number was the same backwards as forwards"
   • 2. onward so as to make progress: "the signing of the treaty is a big step forward" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ into a position of prominence or notice: "he is pushing forward a political ally" Similar towards the frontfrontwardsoutforthinto viewinto the openinto public noticeinto prominence
   • 3. towards the future; ahead in time: "looking forward, earnings are expected to hit £7.2 billion" Similar onwardonwardsonforthforwardsfor everinto eternityuntil now
   • ▪ to an earlier time: "the special issue has been moved forward to November"

   adjective

   • 1. directed or facing towards the front or the direction that one is facing or travelling: "forward flight" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ positioned near the enemy lines: "troops moved to the forward areas" Similar frontadvanceforemostheadleadingfrontalOpposite rear
   • ▪ situated in or towards the bow or nose of a ship or aircraft: "the forward cargo doors"
   • ▪ (of a voltage applied to a semiconductor junction) in the direction which allows significant current to flow.
   • 2. relating to the future: "a twelve-month forward forecast" Similar futureforward-lookingfor the futureprospective
   • 3. progressing towards a successful conclusion: "the decision is a forward step"
   • ▪ further advanced than expected or required: "an alarmingly forward yet painfully vulnerable child" Similar advancedwell advancedearlyprematureprecociousOpposite late
   • 4. (of a person) bold or overfamiliar in manner: "I am not usually a forward sort of person" Similar boldbrazenbrazen-facedbarefacedbrashshamelessimmodestaudaciousdaringpresumptuouspresumingassumingfamiliaroverfamiliarirreverentover-assertiveoverconfidentoverweeningaggressivethrustingpertimpudentimpertinentcheekyinsolentunabashedinformal:brass-neckedcockyfreshOpposite shy

   noun

   • 1. an attacking player in football, hockey, or other sports.
   • 2. agreements to trade specified assets, typically currency, at a specified price at a certain future date.

   verb

   • 1. send (a letter or email) on to a further destination: "my emails were forwarded to a friend" Similar send onredirectreaddresspass onpost on
   • ▪ dispatch or send (a document or goods): "we will forward the parcels to you anywhere in the world" Similar senddispatchtransmitcarryconveydeliverremitmailshipfreightpost
   • 2. help to advance (something); promote: "the scientists are forwarding the development of biotechnology" Similar advancefurtherhastenhurry alongexpediteacceleratespeed upstep upaidassisthelpfosterencouragecontribute topromotefavoursupportbackgive backing tofacilitate

   Word Origin Old Englishforweard (in the sense ‘towards the future’, as in from this day forward), variant of forthweard (see forth, -ward).

   Derivatives

   • 1. forwardly adverb

   Scrabble Points: 14

   • F

     4

   • O

     1

   • R

     1

   • W

     4

   • A

     1

   • R

     1

   • D

     2

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

5. www.fwrd.comFORWARD: The Online Destination for Premier Luxury Fashion

   www.fwrd.com

   • Cached

   FORWARD houses a curated selection from the world's top designers including Saint Laurent, Isabel Marant, Chloe, Valentino, Givenchy, Balenciaga + more.

6. www.merriam-webster.com › dictionary › forwardForward Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › forward

   • Cached

   The meaning of FORWARD is near, being at, or belonging to the forepart. How to use forward in a sentence. Synonym Discussion of Forward.

7. www.dictionary.com › browse › forwardFORWARD Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › forward

   • Cached

   Forward definition: toward or at a place, point, or time in advance; onward; ahead. See examples of FORWARD used in a sentence.

8. dictionary.cambridge.org › dictionary › learner-englishMeaning of forward – Learner’s Dictionary - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › learner-english

   • Cached

   FORWARD definition: 1. towards the direction that is in front of you: 2. towards the future: 3. used to say that…. Learn more.