Yahoo Web Search

Search results

1. Dictionary

   primary

   /ˈprʌɪm(ə)ri/

   adjective

   • 1. of chief importance; principal: "the government's primary aim is to see significant reductions in unemployment" Similar mainchiefkeyprimecentralprincipalforemostfirstmost importantpredominantparamountoverridingmajorrulingdominantmastersupremecardinalpre-eminentultimateinformal:number-oneOpposite secondarysubordinate
   • 2. earliest in time or order: "the primary stage of their political education" Similar originalearliestinitialbeginningfirstessentialfundamentalbasicOpposite secondary
   • ▪ relating to or denoting education for children between the ages of about five and eleven: British "a primary teacher"
   • 3. not derived from, caused by, or based on anything else; original: "his expert handling of the primary and secondary literature is clear on every page"
   • ▪ belonging to or directly derived from the first stage of development or growth: "a primary bone tumour"
   • 4. (of an organic compound) having its functional group located on a carbon atom which is bonded to no more than one other carbon atom: "a primary alcohol"
   • ▪ (chiefly of amines) derived from ammonia by replacement of one hydrogen atom by an organic group.
   • 5. denoting or relating to organisms that produce organic compounds from simple substances such as water and carbon dioxide, typically by photosynthesis: "the organic matter is formed by primary producers such as plants and plankton"
   • ▪ denoting or relating to consumer organisms at the lowest level in a community's food chain, which eat autotrophic organisms: "seed-eating birds and herbivorous insects are primary consumers"
   • 6. relating to or denoting the input side of a transformer or other inductive device.
   • 7. former term for Palaeozoic

   noun

   • 1. (in the US) a preliminary election to appoint delegates to a party conference or to select the candidates for a principal, especially presidential, election: "these two Republicans should win their primaries easily"
   • 2. a primary colour.
   • ▪ a primary feather.
   • ▪ the body orbited by a smaller satellite or companion.
   • ▪ a primary coil or winding in an electrical transformer.
   • 3. the Palaeozoic era. dated

   verb

   • 1. (in the US) run against (the current holder of a political office) in the preliminary election a party uses to select its candidate for the main election: "I'm not primarying the president, and no one else should either unless we want to lose the White House"

   Word Origin late Middle English (in the sense ‘original, not derivative’): from Latin primarius, from primus ‘first’. The noun uses date from the 18th century.

   Scrabble Points: 14

   • P

     3

   • R

     1

   • I

     1

   • M

     3

   • A

     1

   • R

     1

   • Y

     4

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. dictionary.cambridge.org › dictionary › englishPRIMARY | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   PRIMARY definition: 1. more important than anything else; main: 2. of or for the teaching of young children…. Learn more.

3. www.merriam-webster.com › dictionary › primaryPrimary Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › primary

   • Cached

   1. : first in order of time or development : primitive. the primary stage of civilization. the primary lesion of a disease. 2. a. : of first rank, importance, or value : principal. the primary purpose. b. : basic, fundamental. security is a primary need. c. : of, relating to, or constituting the principal flight feathers of a bird's wing. d.

4. dictionary.cambridge.org › us › dictionaryPRIMARY | definition in the Cambridge English Dictionary

   dictionary.cambridge.org › us › dictionary

   • Cached

   PRIMARY meaning: 1. more important than anything else; main: 2. of or for the teaching of young children…. Learn more.

5. www.dictionary.com › browse › primaryPRIMARY Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › primary

   • Cached

   Dec 20, 1991 · Primary definition: first or highest in rank or importance; chief; principal. See examples of PRIMARY used in a sentence.

6. www.collinsdictionary.com › dictionary › englishPRIMARY definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   18 meanings: 1. first in importance, degree, rank, etc 2. first in position or time, as in a series 3. fundamental; basic 4..... Click for more definitions.

7. www.vocabulary.com › dictionary › primaryPrimary - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › primary

   Primary means basically "first." When you vote in a primary, that is the first election in a series. When a matter is of primary concern, it means it's of first importance. Primary school is the first you go to (after nursery school, at least).

8. www.thefreedictionary.com › primaryPrimary - definition of primary by The Free Dictionary

   www.thefreedictionary.com › primary

   • Cached

   Define primary. primary synonyms, primary pronunciation, primary translation, English dictionary definition of primary. adj. 1. First or highest in rank or importance; principal. See Synonyms at chief. 2. a. Occurring first in time or sequence; earliest: the primary stages of...

9. www.oxfordlearnersdictionaries.com › definition › englishprimary adjective - Definition, pictures, pronunciation and usage...

   www.oxfordlearnersdictionaries.com › definition › english

   • Cached

   [usually before noun] main; most important; basic synonym prime. our primary objective/goal/purpose. The primary aim of this course is to improve your spoken English. Our primary concern must be the children. Good healthcare is of primary importance. The film's primary focus is on two families. What is the primary reason for global warming?

10. www.yourdictionary.com › primaryPrimary Definition & Meaning | YourDictionary

    www.yourdictionary.com › primary

    • Cached

    Noun. Verb. Filter. adjective. First in time or order of development; primitive; original; earliest. Webster's New World. Similar definitions. Of or relating to primary schools. American Heritage. Designating colors regarded as basic, or as those from which all others may be derived. Webster's New World.

11. dictionary.cambridge.org › dictionary › learner-englishPRIMARY | meaning - Cambridge Learner's Dictionary

    dictionary.cambridge.org › dictionary › learner-english

    • Cached

    PRIMARY definition: 1. most important: 2. a vote in which people in a political party in the US choose the person who…. Learn more.