Yahoo Web Search

Search results

1. Dictionary

   wave

   /weɪv/

   verb

   • 1. move one's hand to and fro in greeting or as a signal: "he waved to me from the train" Similar gesturegesticulatesignalsignbeckonindicatemotionnodbid
   • ▪ move (one's hand or arm, or something held in one's hand) to and fro: "he waved a sheaf of papers in the air" Similar move to and fromove up and downwagwaggleswingshakeswishsweepswipebrandishflourishflauntwieldflickflutter
   • ▪ convey (a greeting or other message) by waving one's hand or something held in it: "we waved our farewells"
   • ▪ instruct (someone) to move in a particular direction by moving one's hand: "he waved her back"
   • 2. move to and fro with a swaying motion while remaining fixed to one point: "the flag waved in the wind" Similar rippleflutterundulatestirflapswayswingwaftshakequiveroscillatemoveblow
   • 3. style (hair) so that it curls slightly: "her hair had been carefully waved for the evening"
   • ▪ (of hair) grow with a slight curl: "she marvelled at the blueness of his eyes, how straight his nose was, the way his hair waved" Similar curlkinkcoilundulatecrimpfrizzfrizzle

   noun

   • 1. a long body of water curling into an arched form and breaking on the shore: "he was swept out to sea by a freak wave" Similar breakerbillowrollercomberripplewhite horsewhite capswellsurffrothbomborainformal:boomerkahuna
   • ▪ a ridge of water between two depressions in open water: "gulls and cormorants bobbed on the waves"
   • ▪ a shape regarded as resembling a breaking wave: "a wave of treetops stretched to the horizon"
   • ▪ the sea. literary
   • 2. a sudden occurrence of or increase in a phenomenon, feeling, or emotion: "its remarkable how one small gesture can create a wave of kindness" Similar flowrushsurgefloodstreamswelltidedelugetorrentspatebillowsurgerushripplespasmthrillfrissonshivertinglestabdartupsurgewelling upoutbreakrashfeeling
   • 3. a gesture or signal made by moving one's hand to and fro: "he gave a little wave and walked off" Similar gesturegesticulationhand movementsignalsignmotionindication
   • 4. a slightly curling lock of hair: "his hair was drying in unruly waves" Similar curlkinkcorkscrewcrimptwisttwirlringletfrizzcoilloopundulation
   • ▪ a tendency to curl in a person's hair: "her hair has a slight natural wave" Similar curlkinkcorkscrewcrimptwisttwirlringletfrizzcoilloopundulation
   • 5. a periodic disturbance of the particles of a substance which may be propagated without net movement of the particles, such as in the passage of undulating motion, heat, or sound. Similar ripplevibrationoscillationundulation
   • ▪ a single curve in the course of a periodic disturbance of the particles of a substance.
   • ▪ a periodic variation of an electromagnetic field in the propagation of light or other radiation through a medium or vacuum.

   Word Origin Old Englishwafian (verb), from the Germanic base of waver; the noun by alteration (influenced by the verb) of Middle English wawe ‘(sea) wave’.

   Derivatives

   • 1. waveless adjective
   • 2. wave-like adjective

   Scrabble Points: 10

   • W

     4

   • A

     1

   • V

     4

   • E

     1

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. dictionary.cambridge.org › dictionary › englishWAVE | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   Learn the meaning of wave as a verb, noun, and idiom in English. Find out how to use wave in different contexts, such as greeting, moving, curling, or describing energy patterns.

   • English (US)

     WAVE meaning: 1. to raise your hand and move it from side to...

   • Znaczenie Wave, Definicja W Cambridge English Dictionary

     WAVE definicja: 1. to raise your hand and move it from side...

   • New Wave

     NEW WAVE definition: 1. a fashion in something, such as art,...

   • Wave and Pay

     WAVE AND PAY definition: 1. contactless payment 2....

   • Wattle

     WATTLE definition: 1. the loose skin that hangs from the...

3. www.merriam-webster.com › dictionary › waveWave Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › wave

   • Cached

   Learn the various meanings and uses of the word wave as a verb, noun, and noun (2). Find synonyms, examples, etymology, and related phrases of wave.

4. Videos

   • 

     14:43

     youtube.com

     The equation of a wave | Physics | Khan Academy

     29 Jul 2016

     826.1K views

   • 

     6:22

     youtube.com

     GCSE Physics - Intro to Waves - Longitudinal and Transverse Waves #61

     15 Jan 2020

     1M views

   • 

     7:50

     youtube.com

     Different Types of Waves : Longitudinal & Transverse Waves | Mechanical Wave | Physics

     29 Sep 2018

     695.7K views

   View all

5. www.oxfordlearnersdictionaries.com › definition › englishwave noun - Definition, pictures, pronunciation and usage notes...

   www.oxfordlearnersdictionaries.com › definition › english

   • Cached

   Learn the meaning of wave as a noun in different contexts, such as water, energy, movement, activity, and hair. See pictures, pronunciation, collocations, and idioms related to wave.

6. www.dictionary.com › browse › waveWAVE Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › wave

   • Cached

   noun. one of a sequence of ridges or undulations that moves across the surface of a body of a liquid, esp the sea: created by the wind or a moving object and gravity. any undulation on or at the edge of a surface reminiscent of such a wave. a wave across the field of corn. the waves.

7. en.wikipedia.org › wiki › WaveWave - Wikipedia

   en.wikipedia.org › wiki › Wave

   • Cached

   In physics, mathematics, engineering, and related fields, a wave is a propagating dynamic disturbance (change from equilibrium) of one or more quantities. Periodic waves oscillate repeatedly about an equilibrium (resting) value at some frequency.

8. www.britannica.com › science › wave-physicsWave | Behavior, Definition, & Types | Britannica

   www.britannica.com › science › wave-physics

   • Cached

   May 14, 2024 · A wave is a disturbance that travels through a medium or a vacuum with a fixed frequency and wavelength. Learn about the different kinds of waves, how they behave, and how they interact with each other.

9. www.collinsdictionary.com › dictionary › englishWAVE definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   Learn the various meanings and uses of the word wave, from a hand gesture to a physical phenomenon. Find synonyms, examples, pronunciation, and related terms for wave.